Posting my photography and info related to it... and probably some random shit.

15th August 2014

Photo with 5 notes

"This is Inevitable" from my shoot with @stefiedrew for my #venetianmask series. Loving the pose, Stefie is awesome. #venetian #mask #masks #beauty #ink #inked #inkedgirls #giraffe #alt #altmodel #hot #back #curves #thin #blackmask

"This is Inevitable" from my shoot with @stefiedrew for my #venetianmask series. Loving the pose, Stefie is awesome. #venetian #mask #masks #beauty #ink #inked #inkedgirls #giraffe #alt #altmodel #hot #back #curves #thin #blackmask

Tagged: altmodelinkedgirlsblackmaskbeautyvenetianmaskinkedmaskbackmasksvenetianhotgiraffecurvesinkaltthin

14th August 2014

Photo

#tbt #throwbackthursday from my #VenetianMask shoot with Miss @verababylive - #venetian #mask #masks #classic #b&w #blackandwhite #eyes #pretty #beautiful #lady #sparkly

#tbt #throwbackthursday from my #VenetianMask shoot with Miss @verababylive - #venetian #mask #masks #classic #b&w #blackandwhite #eyes #pretty #beautiful #lady #sparkly

Tagged: beautifuleyesbblackandwhitethrowbackthursdayclassicvenetianmaskmasktbtmaskssparklyvenetianprettylady

11th August 2014

Photo with 1 note

Just a simple shot of a #pretty friend - took this a few years back when I was first learning to shoot - the rental place had messed up and could only give me a macro lens to replace the 24-70 I was supposed to be renting… Worked out though, I think … #b&w #blackandwhite #portrait #beauty #lips #eyes #gorgeous -

Just a simple shot of a #pretty friend - took this a few years back when I was first learning to shoot - the rental place had messed up and could only give me a macro lens to replace the 24-70 I was supposed to be renting… Worked out though, I think … #b&w #blackandwhite #portrait #beauty #lips #eyes #gorgeous -

Tagged: eyesbblackandwhitebeautylipsprettygorgeousportrait

10th August 2014

Photo

Just got back from #tmnt - I had set the bar at #GreenLantern and came out of it with a happy #Wolverine - which means it was poorly written, not given the care and attention it deserves, but overall entertaining. Every single scene with human dialogue will make you cringe, but the Turtles themselves feel spot on, great personalities, pretty badass and fun to watch, but I really can’t get over how bad the one liners any human said were, like we are talking #tmnt3 bad…  If you set the bar low you will definitely enjoy the movie, if you’re expecting a decent plot, sensible origin, or a movie that doesn’t make it obvious that the production team thinks the source material is an absolute joke… Then this movie is not for you… B-  (higher grade than it would get if I went into this thinking it would be awesome) - PS - expect every action sequence to be just like anything you’ve seen in the #tranformers movies

Just got back from #tmnt - I had set the bar at #GreenLantern and came out of it with a happy #Wolverine - which means it was poorly written, not given the care and attention it deserves, but overall entertaining. Every single scene with human dialogue will make you cringe, but the Turtles themselves feel spot on, great personalities, pretty badass and fun to watch, but I really can’t get over how bad the one liners any human said were, like we are talking #tmnt3 bad… If you set the bar low you will definitely enjoy the movie, if you’re expecting a decent plot, sensible origin, or a movie that doesn’t make it obvious that the production team thinks the source material is an absolute joke… Then this movie is not for you… B- (higher grade than it would get if I went into this thinking it would be awesome) - PS - expect every action sequence to be just like anything you’ve seen in the #tranformers movies

Tagged: wolverinetmnt3greenlanterntranformerstmnt

7th August 2014

Photo with 9 notes

#tbt #throwbackthursday shoot with @verababylive for @temptressmagazine first issue #hot #ink #inked #inkedgirls #sexy #redhair #latex #tattoos #tattooed #foxy #legs #tmnt #thisisnotaninjaturtle #randomhashtagging #surprisedyourestillreadinghashtags #thankyou

#tbt #throwbackthursday shoot with @verababylive for @temptressmagazine first issue #hot #ink #inked #inkedgirls #sexy #redhair #latex #tattoos #tattooed #foxy #legs #tmnt #thisisnotaninjaturtle #randomhashtagging #surprisedyourestillreadinghashtags #thankyou

Tagged: latexinkedgirlsthisisnotaninjaturtlethrowbackthursdaytattoosrandomhashtaggingsurprisedyourestillreadinghashtagsinkedtmnttbtfoxythankyouhotinksexylegstattooedredhair

30th July 2014

Photo with 69 notes

Daus Cheeky. @verababylive wearing @cinchedtight #corset #bum #butt #ass #peachy #lace #inkedgirls #inked #beauty #verababy #cinchedtight

Daus Cheeky. @verababylive wearing @cinchedtight #corset #bum #butt #ass #peachy #lace #inkedgirls #inked #beauty #verababy #cinchedtight

Tagged: assinkedgirlslacecorsetbeautyinkedbumverababycinchedtightpeachybutt

30th July 2014

Photo with 3 notes

Daus Cheeky. @verababylive wearing @cinchedtight #corset #bum #butt #ass #peachy #lace #inkedgirls #inked #beauty #verababy #cinchedtight

Daus Cheeky. @verababylive wearing @cinchedtight #corset #bum #butt #ass #peachy #lace #inkedgirls #inked #beauty #verababy #cinchedtight

Tagged: assinkedgirlslacecorsetbeautyinkedbumverababycinchedtightpeachybutt

29th July 2014

Photo with 2 notes

Here’s a poster concept I had for #TheDarkKnightRises - been stuck in my head for quite some time now so I’m glad I finally got it out, big thanks to @tony_distef & Daniel for helping out with that.


#joker #batman #thedarkknight #tdk #tdkr #heathledger #hottoys #toyslagram #toygroup_alliance #toyphotography #onesixth #osr #photography #art #conceptart #bane #batman75 #movieposter #jokerposter #tada #dx #dx11 #dx2.0 #jokerdx #dxjoker #toyart

Here’s a poster concept I had for #TheDarkKnightRises - been stuck in my head for quite some time now so I’m glad I finally got it out, big thanks to @tony_distef & Daniel for helping out with that.


#joker #batman #thedarkknight #tdk #tdkr #heathledger #hottoys #toyslagram #toygroup_alliance #toyphotography #onesixth #osr #photography #art #conceptart #bane #batman75 #movieposter #jokerposter #tada #dx #dx11 #dx2.0 #jokerdx #dxjoker #toyart

Tagged: thedarkknightrisesartosrthedarkknightdx11dxjokertadatoyartheathledgerjokerpostertdkmovieposterbatmanphotographydx2jokerdxbanehottoysdxonesixthconceptarttoyslagramtoyphotographyjokerbatman75toygroup_alliancetdkr

29th July 2014

Photo with 4 notes

#Batman #Joker #TheDarkKnight #TheDarkKnightRises #TDK #TDKR #poster #movieposter #Batman75 #heathledger #legend

#Batman #Joker #TheDarkKnight #TheDarkKnightRises #TDK #TDKR #poster #movieposter #Batman75 #heathledger #legend

Tagged: batmanjokerthe dark knightthe dark knight risestdktdkrpostermoviepostermovieposterspostersbatman75heathledgerheath ledgerlegendchristian balegaunted photographygaunted

29th July 2014

Photoset reblogged from Ashe Maree with 34,982 notes

6fatal6enemies6:

venusaurphobia:

toocooltobehipster:

dog escapes cage, then releases other dogs at dog kennel [video]

Rise Of The Planet Of The Dogs

No. Garfield in real life.

Source: toocooltobehipster