Posting my photography and info related to it... and probably some random shit.

14th September 2014

Photo with 1 note

My #art snag from #MTLcomiccon  art by #NicolasSiner - #GoT #Daenerys #dragons #targaryan #MontrealComicCon #MTLcomiccon14

My #art snag from #MTLcomiccon art by #NicolasSiner - #GoT #Daenerys #dragons #targaryan #MontrealComicCon #MTLcomiccon14

Tagged: targaryanartdragonsmtlcomiccon14mtlcomicconnicolassinerdaenerysgotmontrealcomiccon

14th September 2014

Photo

#hodor #HODOR #HODOR!!! #got #gameofthrones #cosplay #MontrealComicCon #montreal #MTLcomiccon

#hodor #HODOR #HODOR!!! #got #gameofthrones #cosplay #MontrealComicCon #montreal #MTLcomiccon

Tagged: mtlcomiccongameofthroneshodormontrealcomiccongotcosplaymontreal

13th September 2014

Photo with 1 note

#MontrealComicCon day2! Come meet #PrincessPeach @verababylive and @gaunted today - booth 2744 / 2742 #montreal #comiccon #MTLcomiccon

#MontrealComicCon day2! Come meet #PrincessPeach @verababylive and @gaunted today - booth 2744 / 2742 #montreal #comiccon #MTLcomiccon

Tagged: comicconmtlcomicconprincesspeachmontrealmontrealcomiccon

7th September 2014

Photo with 1 note

This gentleman was just walking by my booth at #FanExpo when he noticed my work and stopped to show me the homescreen on his #iPhone #nolaughingmatter #joker #jokers #batman #gaunted

This gentleman was just walking by my booth at #FanExpo when he noticed my work and stopped to show me the homescreen on his #iPhone #nolaughingmatter #joker #jokers #batman #gaunted

Tagged: fanexpobatmanjokersgauntedjokeriphonenolaughingmatter

29th August 2014

Photo

Miss @verababylive rocking her #HarleyQuinn #cosplay looked bomb at #fanexpo today!  Have you had a chance to say hey? Swing by booths A323/A325 to see us this weekend! #artistalley - bodysuit by @ladyvioletlove 
#dc #dccomics #batman #joker #harley #bang #hahaha #cosplaygirls #toronto #torontofanexpo #fanexpo2014

Miss @verababylive rocking her #HarleyQuinn #cosplay looked bomb at #fanexpo today! Have you had a chance to say hey? Swing by booths A323/A325 to see us this weekend! #artistalley - bodysuit by @ladyvioletlove
#dc #dccomics #batman #joker #harley #bang #hahaha #cosplaygirls #toronto #torontofanexpo #fanexpo2014

Tagged: fanexpotorontocosplayfanexpo2014harleyquinncosplaygirlsbatmanartistalleydcharleyjokerdccomicsbangtorontofanexpohahaha

15th August 2014

Photo with 6 notes

"This is Inevitable" from my shoot with @stefiedrew for my #venetianmask series. Loving the pose, Stefie is awesome. #venetian #mask #masks #beauty #ink #inked #inkedgirls #giraffe #alt #altmodel #hot #back #curves #thin #blackmask

"This is Inevitable" from my shoot with @stefiedrew for my #venetianmask series. Loving the pose, Stefie is awesome. #venetian #mask #masks #beauty #ink #inked #inkedgirls #giraffe #alt #altmodel #hot #back #curves #thin #blackmask

Tagged: altmodelinkedgirlsblackmaskbeautyvenetianmaskinkedmaskbackmasksvenetianhotgiraffecurvesinkaltthin

14th August 2014

Photo

#tbt #throwbackthursday from my #VenetianMask shoot with Miss @verababylive - #venetian #mask #masks #classic #b&w #blackandwhite #eyes #pretty #beautiful #lady #sparkly

#tbt #throwbackthursday from my #VenetianMask shoot with Miss @verababylive - #venetian #mask #masks #classic #b&w #blackandwhite #eyes #pretty #beautiful #lady #sparkly

Tagged: beautifuleyesbblackandwhitethrowbackthursdayclassicvenetianmaskmasktbtmaskssparklyvenetianprettylady

11th August 2014

Photo with 1 note

Just a simple shot of a #pretty friend - took this a few years back when I was first learning to shoot - the rental place had messed up and could only give me a macro lens to replace the 24-70 I was supposed to be renting… Worked out though, I think … #b&w #blackandwhite #portrait #beauty #lips #eyes #gorgeous -

Just a simple shot of a #pretty friend - took this a few years back when I was first learning to shoot - the rental place had messed up and could only give me a macro lens to replace the 24-70 I was supposed to be renting… Worked out though, I think … #b&w #blackandwhite #portrait #beauty #lips #eyes #gorgeous -

Tagged: eyesbblackandwhitebeautylipsprettygorgeousportrait

10th August 2014

Photo

Just got back from #tmnt - I had set the bar at #GreenLantern and came out of it with a happy #Wolverine - which means it was poorly written, not given the care and attention it deserves, but overall entertaining. Every single scene with human dialogue will make you cringe, but the Turtles themselves feel spot on, great personalities, pretty badass and fun to watch, but I really can’t get over how bad the one liners any human said were, like we are talking #tmnt3 bad…  If you set the bar low you will definitely enjoy the movie, if you’re expecting a decent plot, sensible origin, or a movie that doesn’t make it obvious that the production team thinks the source material is an absolute joke… Then this movie is not for you… B-  (higher grade than it would get if I went into this thinking it would be awesome) - PS - expect every action sequence to be just like anything you’ve seen in the #tranformers movies

Just got back from #tmnt - I had set the bar at #GreenLantern and came out of it with a happy #Wolverine - which means it was poorly written, not given the care and attention it deserves, but overall entertaining. Every single scene with human dialogue will make you cringe, but the Turtles themselves feel spot on, great personalities, pretty badass and fun to watch, but I really can’t get over how bad the one liners any human said were, like we are talking #tmnt3 bad… If you set the bar low you will definitely enjoy the movie, if you’re expecting a decent plot, sensible origin, or a movie that doesn’t make it obvious that the production team thinks the source material is an absolute joke… Then this movie is not for you… B- (higher grade than it would get if I went into this thinking it would be awesome) - PS - expect every action sequence to be just like anything you’ve seen in the #tranformers movies

Tagged: wolverinetmnt3greenlanterntranformerstmnt

7th August 2014

Photo with 9 notes

#tbt #throwbackthursday shoot with @verababylive for @temptressmagazine first issue #hot #ink #inked #inkedgirls #sexy #redhair #latex #tattoos #tattooed #foxy #legs #tmnt #thisisnotaninjaturtle #randomhashtagging #surprisedyourestillreadinghashtags #thankyou

#tbt #throwbackthursday shoot with @verababylive for @temptressmagazine first issue #hot #ink #inked #inkedgirls #sexy #redhair #latex #tattoos #tattooed #foxy #legs #tmnt #thisisnotaninjaturtle #randomhashtagging #surprisedyourestillreadinghashtags #thankyou

Tagged: latexinkedgirlsthisisnotaninjaturtlethrowbackthursdaytattoosrandomhashtaggingsurprisedyourestillreadinghashtagsinkedtmnttbtfoxythankyouhotinksexylegstattooedredhair